PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00065.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 326aa    MW: 37323.3 Da    PI: 4.8831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00065.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.5e-151663148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W+ +Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
  Rsa1.0_00065.1_g00014.1 16 RGPWSYDEDLKLISFINKYGHENWRSLPQQAGLMRCGKSCRLRWINYL 63
                             89********************************************97 PP

2Myb_DNA-binding47.54.1e-1569114148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ eE+e ++++++  G++ W++Ia++++ gRt++++k+ w+++l
  Rsa1.0_00065.1_g00014.1  69 RGNFSVEEEETIIKLHQSIGSK-WSKIASKLP-GRTDNEIKNVWHTHL 114
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-23766IPR009057Homeodomain-like
PROSITE profilePS5129413.6941163IPR017930Myb domain
SuperFamilySSF466891.39E-2814110IPR009057Homeodomain-like
SMARTSM007174.3E-101565IPR001005SANT/Myb domain
PfamPF002496.6E-141663IPR001005SANT/Myb domain
CDDcd001673.54E-81863No hitNo description
PROSITE profilePS5129423.47264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2667118IPR009057Homeodomain-like
SMARTSM007177.7E-1368116IPR001005SANT/Myb domain
PfamPF002498.3E-1469114IPR001005SANT/Myb domain
CDDcd001671.73E-871114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS YDEDLKLISF INKYGHENWR SLPQQAGLMR CGKSCRLRWI  60
NYLRPDVKRG NFSVEEEETI IKLHQSIGSK WSKIASKLPG RTDNEIKNVW HTHLKKKMSS  120
RTNLNADDET GTKGSLNREK TFQESSPNAS MSFAGSKISS KEDGAQIGEM FEYIEGHSEV  180
TRTSEEIDKP ELLEIPFGVD PDHIWSFING YDSFGGSKIS SKEDGAQIGD MFEYLEGHSE  240
VKRTLKEVDK PELLEIPFGV DPDIWHFING YDSFQQPENS LAPRDHQDSQ EDEVDKWFKY  300
LETELGLEEN DSQQQQQNDT NKESSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24161207110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585304.11e-139PREDICTED: myb-related protein Zm1-like
TrEMBLA0A0D3CAS71e-138A0A0D3CAS7_BRAOL; Uncharacterized protein
STRINGBra026048.1-P1e-128(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-127myb domain protein 58